Overview of Antalyaevdenevenakliye.org

Antalyaevdenevenakliye.org was first analyzed by us on Oct 13, 2013. We can see that the website is ONLINE. It currently ranks #5,143,606 in the world according to Alexa. The lower the Alexa Rank, the better and this is in our opinion a good starting rank. It is most popular in where it currently ranks #-1. The website has an okay Google PageRank of 2. The IP address of the server antalyaevdenevenakliye.org is hosted on is 88.150.231.140 and is based in Gosport, United Kingdom .

Website Overview

Name: Favicon Antalyaevdenevenakliye
Website URL: antalyaevdenevenakliye.org
Page Rank: PR
Alexa Rank: Alexa Rank #5,143,606
Website Speed: 0.113 seconds
Language: Turkish
IP Address: 88.150.231.140
Back Links (Alexa) 13
Popular Keywords: Evden, Antalya, Nakliyat, Nakliye, Taşımacılık, Sektöründe, Devamı
Site last checked on Nov 21, 2013. Update Now

Websites Like Antalyaevdenevenakliye.org

# URL PR  
1 nakliyatcilarkosesi.com0Websites Like nakliyatcilarkosesi.com
2 izmirevdenevenakliyatfirmalari.net0Websites Like izmirevdenevenakliyatfirmalari.net
3 antalyanakliyatfirmalari.net0Websites Like antalyanakliyatfirmalari.net
4 evdennakliyeeve.org0Websites Like evdennakliyeeve.org
5 antnak.comWebsites Like antnak.com
6 evdeneveantalya.netWebsites Like evdeneveantalya.net
7 ozeksiogluevdeneve.com6Websites Like ozeksiogluevdeneve.com
8 nakliyeilani.com3Websites Like nakliyeilani.com
9 agaoglunakliyat.com3Websites Like agaoglunakliyat.com
10 evdeneve.gen.tr3Websites Like evdeneve.gen.tr

Website Owner Information

We have extracted information from different sources about the ownership of antalyaevdenevenakliye.org.
Owner: AlizeTR Bilisim Hizmetleri
Phone: 5356429622
Address: Guvenlik Mah. Turgut Reis Cad., Antalya, Merkez, 07100, Turkey

Social Statistics

Facebook Stats
Likes: 0 Shares: 0
Clicks: 0 Comments: 0

Website's On-page Analysis

HTML Tag Elements
Paragraph: 10 Strong: 2
Tables: 0 Lists: 5
Total Images: 3 Missing Alt: 0
Internal Links: 19 External Links: 5
Forms: 1 Fields: 3
Page Headings
H1 Tags: 1 H2 Tags: 1
H3 Tags: 4 H4 Tags: 2
H5 Tags: 3 H6 Tags: 0
Includes
Iframe: 0 Flash: 0
CSS: 2 Scripts: 5
Page Statistics
File Size: 44.46 KB Word Count: 766
Charset: UTF-8 Doctype: Yes
Viewport: No Google Analytics: Yes
Webmaster Tools: Yes Bing Webmaster Tools: No

Website Meta Tags

Meta elements are HTML elements used to provide structured metadata about a Web page. We have listed below the meta elements we have extracted from antalyaevdenevenakliye.org.
Name Contents
Title Tag:  Antalya Evden Eve Nakliye | Antalya Evden Eve | Antalya Evden Eve Nakliyat | Antalya Evden Eve Taşımacılık
Description Tag: Antalyal Evden Eve Nakliyat Firması. Antalya Nakliyat işlerinde kolay ve hızlı taşımacılığın adresi.
Keywords Tag: antalya evden eve nakliye, antalya evden eve, antalya evden eve nakliyat, evden eve antalya, antalya asansörlü taşımacılık, evden eve nakliyat antalya
X-UA-Compatible IE=EmulateIE7
alexaVerifyID 4aS7lWYg9NiF5Eiou5k8eMyQnaE
google-site-verification kCjOh4J3NemRzidlwJ3G-_kXqP2-XOnghVsi_n2ANNs
revisit-after 7
title Antalya Evden Eve,Antalya Evden Eve Nakliye,Antalya Evden Eve Nakliyat,Antalya Evden Eve Taşımacılık
Content-Type text/html; charset=utf-8
Content-Language tr
language Turkish
rating general
abstract antalya nakliye, antalya nakliyat
robots all
googlebot Index, Follow
reply-to [email protected]

Web Server Location

IP Address: 88.150.231.140
Location: Gosport, England, United Kingdom
Timezone: +01:00

Traffic Report

Alexa Global Rank:

Keyword Analysis

We have attempted to list all keywords that have been repeated more than once and are topic related.
# Keyword Repeated Density
1 evden 42 5.48%
2 antalya 39 5.09%
3 nakliyat 23 3%
4 nakliye 16 2.09%
5 taşımacılık 12 1.57%
6 sektöründe 5 0.65%
7 devamı 4 0.52%
8 asansörlü 3 0.39%
9 özel 2 0.26%
10 olarak 2 0.26%

Website's HTTP Request

Name Content
X-Powered-By-PleskPleskWin
Accept-Rangesbytes
Content-Length46051
Content-Typetext/html
DateSun, 13 Oct 2013 12
ETag"c2abd64448acce1
Last-ModifiedSun, 08 Sep 2013 04
ServerMicrosoft-IIS/7.5
X-Powered-ByASP.NET

Top 1 Sites with Similar Domain

# URL Page Rank Alexa Rank
1 antalyaevdenevenakliye.net3922273

Website Widgets

Add a widget to your website to gain more user confidence. Just copy & paste the html snippet into your website!

Follow Us