Overview of Evdenevenakliyatantalya.com.tr

Evdenevenakliyatantalya.com.tr was first analyzed by us on Oct 10, 2013. We can see that the website is ONLINE. It currently ranks #11,929,777 in the world according to Alexa. The lower the Alexa Rank, the better and this is in our opinion a good starting rank. It is most popular in where it currently ranks #-1. The website has a poor Google PageRank of 0. The IP address of the server evdenevenakliyatantalya.com.tr is hosted on is 88.150.231.140 and is based in Gosport, United Kingdom .

Website Overview

Name: Favicon Evdenevenakliyatantalya
Website URL: evdenevenakliyatantalya.com.tr
Page Rank: PR
Alexa Rank: Alexa Rank #11,929,777
Website Speed: 0.448 seconds
Language: Turkish
Back Links (Alexa) 3
Popular Keywords: Antalya, Nakliyat, Evden, Isparta, Galeri, Eve
Site last checked on Oct 31, 2013. Update Now

Websites Like Evdenevenakliyatantalya.com.tr

# URL PR  
1 evdeneve.gen.tr3Websites Like evdeneve.gen.tr
2 antalyaevdeneve-nakliyat.net0Websites Like antalyaevdeneve-nakliyat.net
3 antalyaevdenevenakliye.org2Websites Like antalyaevdenevenakliye.org
4 nakliye.biz.tr0Websites Like nakliye.biz.tr
5 izmirevdenevenakliyatfirmalari.net0Websites Like izmirevdenevenakliyatfirmalari.net
6 nakliyatantalya.net0Websites Like nakliyatantalya.net
7 antalyaevdenevenakliye.net0Websites Like antalyaevdenevenakliye.net
8 antalyanakliyatfirmalari.net0Websites Like antalyanakliyatfirmalari.net
9 antalyanakliyat-firmalari.com0Websites Like antalyanakliyat-firmalari.com
10 istanbulevdeneve.biz.tr0Websites Like istanbulevdeneve.biz.tr

Social Statistics

Facebook Stats
Likes: 0 Shares: 0
Clicks: 0 Comments: 0

Website's On-page Analysis

HTML Tag Elements
Paragraph: 2 Strong: 0
Tables: 0 Lists: 0
Total Images: 17 Missing Alt: 0
Internal Links: 28 External Links: 4
Forms: 0 Fields: 0
Page Headings
H1 Tags: 2 H2 Tags: 0
H3 Tags: 0 H4 Tags: 0
H5 Tags: 0 H6 Tags: 0
Includes
Iframe: 0 Flash: 0
CSS: 5 Scripts: 17
Page Statistics
File Size: 11.61 KB Word Count: 51
Charset: UTF-8 Doctype: Yes
Viewport: No Google Analytics: No
Webmaster Tools: No Bing Webmaster Tools: No

Website Meta Tags

Meta elements are HTML elements used to provide structured metadata about a Web page. We have listed below the meta elements we have extracted from evdenevenakliyatantalya.com.tr.
Name Contents
Title Tag: Antalya Evden Eve Nakliyat | Evden Eve Antalya | Antalya Nakliyat
Description Tag: Antalya Evden Eve Sektöründe Referanslarıyla Tek Lider Firma Öz Isparta Nakliyat
Keywords Tag: antalya evden eve nakliyat, evden eve nakliyat antalya, antalya asansörlü taşımacılık, evden eve antalya, antalya evden eve, antalya nakliyat, nakliyat antalya
Content-Type text/html; charset=utf-8
Pragma cache
ROBOTS All

Web Server Location

IP Address: 88.150.231.140
Location: Gosport, England, United Kingdom
Timezone: +01:00

Traffic Report

Alexa Global Rank:

Keyword Analysis

We have attempted to list all keywords that have been repeated more than once and are topic related.
# Keyword Repeated Density
1 antalya 25 49.02%
2 nakliyat 18 35.29%
3 evden 16 31.37%
4 isparta 4 7.84%
5 galeri 3 5.88%
6 eve 2 3.92%

Website's HTTP Request

Name Content
X-Powered-By-PleskPleskWin
Content-Length12043
Content-Typetext/html
DateThu, 10 Oct 2013 17
ETag"4924655cdfc5ce1
Last-ModifiedThu, 10 Oct 2013 17
ServerMicrosoft-IIS/7.5
X-Powered-ByASP.NET

Top 1 Sites with Similar Domain

# URL Page Rank Alexa Rank
1 evdenevenakliyatantalya.org

Website Widgets

Add a widget to your website to gain more user confidence. Just copy & paste the html snippet into your website!

Follow Us